Structure of PDB 8t5h Chain l

Receptor sequence

>8t5hl (length=114) Species: 562 (Escherichia coli)

ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEG
QIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQR
TKTNARTRKGPRKP

3D structure

• PDB: 8t5h How Dedicated Ribosomes Translate a Leaderless mRNA.
• Chain: l
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	l	M80 D81 R91	M80 D81 R91
BS02	rna	l	I16 Y22 G23 G25 T27 R28 I72 S75 Y85 R86 H90 L94 P95 V96 R97 G98 Q99 R100 T101 K102 T103 N104 A105 R106 T107 R108 K109 R112 K113	I16 Y22 G23 G25 T27 R28 I72 S75 Y85 R86 H90 L94 P95 V96 R97 G98 Q99 R100 T101 K102 T103 N104 A105 R106 T107 R108 K109 R112 K113

External links

• PDB: RCSB:8t5h, PDBe:8t5h, PDBj:8t5h
• PDBsum: 8t5h
• PubMed: 38185325
• UniProt: S1P5F8