Structure of PDB 8qcq Chain l

Receptor sequence

>8qcql (length=135) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

PTINQLIRKGRVSKVENSKSPALNKGYNSFKKEHTNVSSPQKRGVCTRVG
TMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVK
DLPGVRYHIVRGALDTAGVENRAQGRSKYGTKKPK

3D structure

• PDB: 8qcq Novel arrest peptides induce ribosome stalling by short circuiting the ribosomal peptidyltransferase activity
• Chain: l
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	l	P2 T3 N5 Q6 L7 R9 K10 R12 V13 S14 K15 S19 N29 S30 F31 K33 S40 P41 Q42 K43 R44 K56 K57 N59 S60 A61 L62 R63 T71 Y79 G82 I83 L94 R96 G97 R99 K101 D102 P104 R107 V120 E121 N122 R123 Q125 G126 R127 S128 G131 T132 K133 K134	P1 T2 N4 Q5 L6 R8 K9 R11 V12 S13 K14 S18 N28 S29 F30 K32 S39 P40 Q41 K42 R43 K55 K56 N58 S59 A60 L61 R62 T70 Y78 G81 I82 L93 R95 G96 R98 K100 D101 P103 R106 V119 E120 N121 R122 Q124 G125 R126 S127 G130 T131 K132 K133

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation
• GO:0046677 response to antibiotic

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8qcq, PDBe:8qcq, PDBj:8qcq
• PDBsum: 8qcq
• PubMed: 38503735
• UniProt: P21472|RS12_BACSU Small ribosomal subunit protein uS12 (Gene Name=rpsL)