Structure of PDB 8q5i Chain l

Receptor sequence

>8q5il (length=361) Species: 5476 (Candida albicans) [Search protein sequence]

SRPQVSVISVKGEQGSSQLPLPAVFAAPVRPDLVHSVFVRVNKNKRQAYA
VAENAGHQTSAESWGTGRAVARIPRVGGGGTHRSGQAAFGNMCRGGRMFA
PTKTWRRWNVKVNHNEKRYATASAIAASAVTSLVLARGHRVEQVKELPLV
VSNEFESVTKTKDAVAVLKAVGAHKDVVKVIKSKKLRAGKGKLRGRRFTQ
RRGPLVVYAQDNGIVKALRNVPGVETASVKHLGLLQLAPGAHLGRFIIWT
QGAFESLDSVYGSDSTKSIKSGYTLPSNIISNTDVTRLINSAEVQAVVRP
AGEKTQKKSHVLKKNPLKNKQVLLRLNPYAKAYAAEKVGSAKVEQAKVKP
SKGQFAEVLKN

3D structure

PDB

8q5i Structural characterization of cephaeline binding to the eukaryotic ribosome using Cryo-Electron Microscopy

Chain

Resolution

2.45 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	l	R32 L35 H37 R42 N44 K45 N46 K47 R48 Q49 Y51 V53 A54 E55 A57 H59 Q60 T61 S62 T68 G69 A71 V72 A73 R74 I75 P76 G81 G82 T83 H84 R85 Q88 A89 N93 M94 R96 G97 R99 M100 F101 A102 K105 W107 R108 R109 K113 N115 H116 N117 E118 K119 R120 R139 R142 K162 T163 K164 K181 K184 S185 K187 L188 R189 A190 G191 K194 R196 R198 R203 R204 Y210 V217 K218 R221 N222 T228 H233 G235 G242 H244 K272 S273 I291 N292 Q297 R301 A303 G304 E305 K306 Q308 K309 K310 S311 V313 L314 K316 N321 Q323 R327 A332 K333 Y335 A336 G341 S342 K344 V345 Q347 V350 K351 P352 S353 L361	R30 L33 H35 R40 N42 K43 N44 K45 R46 Q47 Y49 V51 A52 E53 A55 H57 Q58 T59 S60 T66 G67 A69 V70 A71 R72 I73 P74 G79 G80 T81 H82 R83 Q86 A87 N91 M92 R94 G95 R97 M98 F99 A100 K103 W105 R106 R107 K111 N113 H114 N115 E116 K117 R118 R137 R140 K160 T161 K162 K179 K182 S183 K185 L186 R187 A188 G189 K192 R194 R196 R201 R202 Y208 V215 K216 R219 N220 T226 H231 G233 G240 H242 K270 S271 I289 N290 Q295 R299 A301 G302 E303 K304 Q306 K307 K308 S309 V311 L312 K314 N319 Q321 R325 A330 K331 Y333 A334 G339 S340 K342 V343 Q345 V348 K349 P350 S351 L359
BS02	rna	l	A50 A52 A54 K194 L195	A48 A50 A52 K192 L193

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8q5i, PDBe:8q5i, PDBj:8q5i
PDBsum	8q5i
PubMed
UniProt	A0A8H6F4H4

[Back to BioLiP]