Structure of PDB 8p2h Chain l

Receptor sequence
>8p2hl (length=118) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
VKKNIENGVAHIRSTFNNTIVTITDEFGNALSWSSAGALGFKGSKKSTPF
AAQMASETASKSAMEHGLKTVEVTVKGPGPGRESAIRALQSAGLEVTAIR
DVTPVPHNGCRPPKRRRV
3D structure
PDB8p2h Staphylococcus aureus 70S ribosome with elongation factor G locked with fusidic acid with a tRNA in pe/E chimeric hybrid state
Chainl
Resolution2.49 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna l R24 N28 N29 G39 A41 W44 G48 A49 G54 S55 K57 P115 V116 P117 H118 N119 G120 C121 R122 K125 R127 R128 V129 R13 N17 N18 G28 A30 W33 G37 A38 G43 S44 K46 P104 V105 P106 H107 N108 G109 C110 R111 K114 R116 R117 V118
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8p2h, PDBe:8p2h, PDBj:8p2h
PDBsum8p2h
PubMed38902339
UniProtQ2FW31|RS11_STAA8 Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]