Structure of PDB 8ovj Chain l

Receptor sequence
>8ovjl (length=50) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]
GRFKPLAVKKKYAKKMNQNKPVPYWIRLRTGNRIKWNEKRRHWRRTKLNY
3D structure
PDB8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
Chainl
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna l G2 R3 F4 Y13 M17 R34 K36 W37 N38 E39 R41 R42 H43 W44 K48 L49 N50 G1 R2 F3 Y12 M16 R33 K35 W36 N37 E38 R40 R41 H42 W43 K47 L48 N49
BS02 rna l L7 K12 K15 Q19 W26 T31 I35 K40 L6 K11 K14 Q18 W25 T30 I34 K39
BS03 rna l R3 K10 R45 R2 K9 R44
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ovj, PDBe:8ovj, PDBj:8ovj
PDBsum8ovj
PubMed38722744
UniProtQ4QEQ0

[Back to BioLiP]