Structure of PDB 8bh6 Chain l

Receptor sequence

>8bh6l (length=135) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325)

PTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRGVCTRVG
TMTPRKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVR
DLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPK

3D structure

• PDB: 8bh6 Ribosome maturation factor P (RimP) from Staphylococcus aureus
• Chain: l
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	l	P2 T3 N5 Q6 R9 R12 Q13 S14 K15 K17 K18 D20 K26 F28 N29 S30 K31 T36 L38 S40 P41 Q42 K43 R44 R56 N59 S60 A61 L62 R63 K64 S71 G82 I83 R96 G97 V100 R101 P104 R107 A114 R123 R124 Q125 S128 T132 K133 K134	P1 T2 N4 Q5 R8 R11 Q12 S13 K14 K16 K17 D19 K25 F27 N28 S29 K30 T35 L37 S39 P40 Q41 K42 R43 R55 N58 S59 A60 L61 R62 K63 S70 G81 I82 R95 G96 V99 R100 P103 R106 A113 R122 R123 Q124 S127 T131 K132 K133

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8bh6, PDBe:8bh6, PDBj:8bh6
• PDBsum: 8bh6
• UniProt: P0A0H0|RS12_STAA8 Small ribosomal subunit protein uS12 (Gene Name=rpsL)