Structure of PDB 8am5 Chain l

Receptor sequence
>8am5l (length=143) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence]
NQVVQAYNGDPFVGHLSTPISDSAFTRTFIGNLPAYRKGLSPILRGLEVG
MAHGYFLIGPWTLLGPLRDSEYQYIGGLIGALALILVATAALSSYGLVTF
QGEQGSGDTLQTADGWSQFAAGFFVGGMGGAFVAYFLLENLSV
3D structure
PDB8am5 The Ycf48 accessory factor occupies the site of the oxygen-evolving manganese cluster during photosystem II biogenesis.
Chainl
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA l V8 P23 V4 P19
BS02 CLA l H19 T22 I24 H15 T18 I20
BS03 CLA l P64 W65 L68 R72 P60 W61 L64 R68
BS04 CLA l I83 A87 I79 A83
BS05 CLA l E52 M55 E48 M51
BS06 CLA l P38 A39 V53 A56 H57 F60 P34 A35 V49 A52 H53 F56
BS07 CLA l Y59 F60 G63 P64 L67 L142 Y55 F56 G59 P60 L63 L138
Gene Ontology
Cellular Component
GO:0005886 plasma membrane
GO:0009522 photosystem I
GO:0009538 photosystem I reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8am5, PDBe:8am5, PDBj:8am5
PDBsum8am5
PubMed37542031
UniProtP37277|PSAL_SYNY3 Photosystem I reaction center subunit XI (Gene Name=psaL)

[Back to BioLiP]