Structure of PDB 8agz Chain l

Receptor sequence

>8agzl (length=361) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

SRPQVTVHSLTGEATANALPLPAVFSAPIRPDIVHTVFTSVNKNKRQAYA
VSEKAGHQTSAESWGTGRAVARIPRVGGGGTGRSGQGAFGNMCRGGRMFA
PTKTWRKWNVKVNHNEKRYATASAIAATAVASLVLARGHRVEKIPEIPLV
VSTDLESIQKTKEAVAALKAVGAHSDLLKVLKSKKLRAGKGKYRNRRWTQ
RRGPLVVYAEDNGIVKALRNVPGVETANVASLNLLQLAPGAHLGRFVIWT
EAAFTKLDQVWGSETVASSKVGYTLPSHIISTSDVTRIINSSEIQSAIRP
AGQATQKRTHVLKKNPLKNKQVLLRLNPYAKVFAAEKLGSKKAEKTGTKP
AAVFTETLKHD

3D structure

PDB

8agz Molecular basis of eIF5A-dependent CAT tailing in eukaryotic ribosome-associated quality control.

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	l	I34 H36 T40 V42 K44 N45 K46 R47 Q48 Y50 V52 S53 E54 A56 H58 Q59 T60 S61 T67 G68 A70 V71 R73 P75 R76 G81 T82 R84 Q87 N92 M93 R95 G96 R98 M99 F100 A101 P102 K104 W106 R107 K108 K112 N114 H115 N116 E117 K118 R119 R138 R141 K161 T162 K163 K180 K183 S184 K186 L187 R188 A189 G190 K191 K193 Y194 R195 N196 R197 W199 R202 R203 Y209 K217 R220 N221 T227 S232 N234 P240 G241 H243 K271 V272 N291 R300 A302 G303 A305 Q307 K308 R309 V312 L313 K315 N320 Q322 R326 A331 K332 F334 A335 G340 S341 K342 K343 A344 T347 T349 P351 L359 K360	I33 H35 T39 V41 K43 N44 K45 R46 Q47 Y49 V51 S52 E53 A55 H57 Q58 T59 S60 T66 G67 A69 V70 R72 P74 R75 G80 T81 R83 Q86 N91 M92 R94 G95 R97 M98 F99 A100 P101 K103 W105 R106 K107 K111 N113 H114 N115 E116 K117 R118 R137 R140 K160 T161 K162 K179 K182 S183 K185 L186 R187 A188 G189 K190 K192 Y193 R194 N195 R196 W198 R201 R202 Y208 K216 R219 N220 T226 S231 N233 P239 G240 H242 K270 V271 N290 R299 A301 G302 A304 Q306 K307 R308 V311 L312 K314 N319 Q321 R325 A330 K331 F333 A334 G339 S340 K341 K342 A343 T346 T348 P350 L358 K359
BS02	rna	l	A49 A51 K193 Y194	A48 A50 K192 Y193
BS03	peptide	l	G81 T82	G80 T81

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8agz, PDBe:8agz, PDBj:8agz
PDBsum	8agz
PubMed	36804914
UniProt	P10664\|RL4A_YEAST Large ribosomal subunit protein uL4A (Gene Name=RPL4A)

[Back to BioLiP]