Structure of PDB 7ymi Chain l

Receptor sequence
>7ymil (length=36) Species: 329726 (Acaryochloris marina MBIC11017) [Search protein sequence]
TPNPNKQPVELNRASLFIGLLLVLVLALLFSSYFFN
3D structure
PDB7ymi Structure of a large photosystem II supercomplex from Acaryochloris marina.
Chainl
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide l R15 F19 L23 L26 F37 R13 F17 L21 L24 F35
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ymi, PDBe:7ymi, PDBj:7ymi
PDBsum7ymi
PubMed38394197
UniProtB0C6T1|PSBL_ACAM1 Photosystem II reaction center protein L (Gene Name=psbL)

[Back to BioLiP]