Structure of PDB 7vor Chain l

Receptor sequence

>7vorl (length=281) Species: 272943 (Cereibacter sphaeroides 2.4.1) [Search protein sequence]

ALLSFERKYRVPGGTLVGGNLFDFWVGPFYVGFFGVATFFFAALGIILIA
WSAVLQGTWNPQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSW
ALREVEICRKLGIGYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGI
WTHLDWVSNTGYTYGNFHYNPAHMIAISFFFTNALALALHGALVLSAANP
EKGKEMRTPDHEDTFFRDLVGYSIGTLGIHRLGLLLSLSAVFFSALCMII
TGTIWFDQWVDWWQWWVKLPWWANIPGGING

3D structure

PDB

7vor Structural basis for the assembly and quinone transport mechanisms of the dimeric photosynthetic RC-LH1 supercomplex.

Chain

Resolution

2.74 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BCL	l	F97 A124 L131 V157 T160 Y162 F167 H168 H173 I177 F180 F181 S244 M248	F97 A124 L131 V157 T160 Y162 F167 H168 H173 I177 F180 F181 S244 M248
BS02	BCL	l	Y128 L131 F146 I150 W151 H153 L154	Y128 L131 F146 I150 W151 H153 L154
BS03	BPH	l	A42 C92 A93 F97 W100 E104 A120 F121 A124 Y148 G149 H153 V241	A42 C92 A93 F97 W100 E104 A120 F121 A124 Y148 G149 H153 V241
BS04	U10	l	S178 F179 T182 L189 H190 L193 E212 D213 F216 Y222 S223 I224 G225 I229	S178 F179 T182 L189 H190 L193 E212 D213 F216 Y222 S223 I224 G225 I229
BS05	U10	l	P171 M174 I175 W255 W262 W263	P171 M174 I175 W255 W262 W263
BS06	FE2	l	H190 H230	H190 H230
BS07	BCL	l	H168 M174 I177 S178 T182	H168 M174 I177 S178 T182
BS08	BPH	l	F181 L185 L189	F181 L185 L189
BS09	U10	l	F29 V31 G35 V36 F39 W100	F29 V31 G35 V36 F39 W100

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7vor, PDBe:7vor, PDBj:7vor
PDBsum	7vor
PubMed	35418573
UniProt	Q3J1A5\|RCEL_CERS4 Reaction center protein L chain (Gene Name=pufL)

[Back to BioLiP]