Structure of PDB 7sa4 Chain l

Receptor sequence

>7sa4l (length=151) Species: 562 (Escherichia coli) [Search protein sequence]

PRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLA
QRSGKSELEAFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAM
RWIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDVHRMAEANKAF
A

3D structure

PDB

7sa4 Sequential rescue and repair of stalled and damaged ribosome by bacterial PrfH and RtcB.

Chain

Resolution

2.55 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	l	P2 R3 R4 V6 R10 K25 N28 L30 M31 V32 D33 G34 K35 K36 S37 I42 K76 R79 S83 R92 R95 R102 R109 K114 S115 M116	P1 R2 R3 V5 R9 K24 N27 L29 M30 V31 D32 G33 K34 K35 S36 I41 K75 R78 S82 R91 R94 R101 R108 K113 S114 M115
BS02	rna	l	S77 T84 Q86 R143	S76 T83 Q85 R142
BS03	rna	l	G81 G82	G80 G81

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0017148	negative regulation of translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0016020	membrane
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7sa4, PDBe:7sa4, PDBj:7sa4
PDBsum	7sa4
PubMed	35858322
UniProt	P02359\|RS7_ECOLI Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]