Structure of PDB 7r6k Chain l

Receptor sequence
>7r6kl (length=176) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]
MRQLTEEETKVVFEKLAGYIGRNISFLVDNKELPHVFRLQKDRVYYVPDH
VAKLATSVARPNLMSLGICLGKFTKTGKFRLHITSLTVLAKHAKYKIWIK
PNGEMPFLYGNHVLKAHVGKMSDDIPEHAGVIVFAMNDVPLGFGVSAKST
SESRNMQPTGIVAFRQADIGEYLRDE
3D structure
PDB7r6k Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
Chainl
Resolution3.17 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna l M1 R2 K15 Q40 K53 T56 S57 A59 R60 K72 T74 T76 K78 R80 L81 H128 F164 Q166 M1 R2 K15 Q40 K53 T56 S57 A59 R60 K72 T74 T76 K78 R80 L81 H128 F164 Q166
BS02 peptide l L108 Y109 G110 D168 G170 L173 R174 L108 Y109 G110 D168 G170 L173 R174
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0042254 ribosome biogenesis
GO:0042255 ribosome assembly
GO:0042273 ribosomal large subunit biogenesis
GO:1902626 assembly of large subunit precursor of preribosome
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r6k, PDBe:7r6k, PDBj:7r6k
PDBsum7r6k
PubMed36482249
UniProtQ08962|NIP7_YEAST 60S ribosome subunit biogenesis protein NIP7 (Gene Name=NIP7)

[Back to BioLiP]