Structure of PDB 7qi4 Chain l

Receptor sequence
>7qi4l (length=82) Species: 9606 (Homo sapiens) [Search protein sequence]
ALKDPDVCTDPVQLTTYAMGVNIYKEGQDVPLKPDAEYPEWLFEMNLGPP
KTLEELDPESREYWRRLRKQNIWRHNRLSKNK
3D structure
PDB7qi4 Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.
Chainl
Resolution2.21 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna l P104 R115 R119 R120 R122 K123 I126 W127 H129 N130 S133 P50 R61 R65 R66 R68 K69 I72 W73 H75 N76 S79
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7qi4, PDBe:7qi4, PDBj:7qi4
PDBsum7qi4
PubMed38769321
UniProtQ6P161|RM54_HUMAN Large ribosomal subunit protein mL54 (Gene Name=MRPL54)

[Back to BioLiP]