Structure of PDB 7pqd Chain l

Receptor sequence

>7pqdl (length=281) Species: 272943 (Cereibacter sphaeroides 2.4.1)

ALLSFERKYRVPGGTLVGGNLFDFWVGPFYVGFFGVATFFFAALGIILIA
WSAVLQGTWNPQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSW
ALREVEICRKLGIGYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGI
WTHLDWVSNTGYTYGNFHYNPAHMIAISFFFTNALALALHGALVLSAANP
EKGKEMRTPDHEDTFFRDLVGYSIGTLGIHRLGLLLSLSAVFFSALCMII
TGTIWFDQWVDWWQWWVKLPWWANIPGGING

3D structure

• PDB: 7pqd Cryo-EM structure of the dimeric Rhodobacter sphaeroides RC-LH1 core complex at 2.9 angstrom : the structural basis for dimerisation.
• Chain: l
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	l	F22 F33	F22 F33
BS02	SP2	l	F40 V98	F40 V98
BS03	BCL	l	F97 A124 L131 W156 V157 Y162 F167 H168 H173 I177 F180 S244 M248	F97 A124 L131 W156 V157 Y162 F167 H168 H173 I177 F180 S244 M248
BS04	BPH	l	W100 E104 F121 Y148 I150 H153 V241	W100 E104 F121 Y148 I150 H153 V241
BS05	U10	l	S178 F179 T182 H190 L193 F216 Y222 S223 I224 G225 I229	S178 F179 T182 H190 L193 F216 Y222 S223 I224 G225 I229
BS06	UQ1	l	W263 W265 W266	W263 W265 W266
BS07	BCL	l	Y128 F146 I150 W151 H153 L154	Y128 F146 I150 W151 H153 L154
BS08	BPH	l	F181 L185 L189	F181 L185 L189
BS09	U10	l	F24 V26 F29 V31 G35 F39 W100	F24 V26 F29 V31 G35 F39 W100
BS10	BCL	l	H168 M174 I177 S178 T182	H168 M174 I177 S178 T182
BS11	FE	l	H190 H230	H190 H230

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 30 12:45:33 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7pqd', asym_id = 'l', title = 'Cryo-EM structure of the dimeric Rhodobacter sph...ngstrom : the structural basis for dimerisation. '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7pqd', asym_id='l', title='Cryo-EM structure of the dimeric Rhodobacter sph...ngstrom : the structural basis for dimerisation. ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0009772,0019684,0030077,0045156', uniprot = '', pdbid = '7pqd', asym_id = 'l'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009772,0019684,0030077,0045156', uniprot='', pdbid='7pqd', asym_id='l')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>