Structure of PDB 7po4 Chain l

Receptor sequence
>7po4l (length=82) Species: 9606 (Homo sapiens) [Search protein sequence]
ALKDPDVCTDPVQLTTYAMGVNIYKEGQDVPLKPDAEYPEWLFEMNLGPP
KTLEELDPESREYWRRLRKQNIWRHNRLSKNK
3D structure
PDB7po4 Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
Chainl
Resolution2.56 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna l P104 R115 R119 R120 R122 K123 I126 W127 H129 N130 S133 K134 K136 P50 R61 R65 R66 R68 K69 I72 W73 H75 N76 S79 K80 K82
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7po4, PDBe:7po4, PDBj:7po4
PDBsum7po4
PubMed35676484
UniProtQ6P161|RM54_HUMAN Large ribosomal subunit protein mL54 (Gene Name=MRPL54)

[Back to BioLiP]