Structure of PDB 7pir Chain l

Receptor sequence

>7pirl (length=136) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]

MLQPKRTKYRKPHNVSYEGKAKGNSYVAFGEYGLVATKGNWIDARAIESA
RIAISKCLGKTGKMWIRIFPHMSKTKKPLEVRMGSGKGNPEFWVAVVKQG
TVMFEVANIPESQMIKALTRAGHKLPVTWKILKREE

3D structure

PDB

7pir Visualizing translation dynamics at atomic detail inside a bacterial cell.

Chain

Resolution

12.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	l	P4 K5 R6 T7 K8 Y9 R10 K11 P12 H13 N14 K20 K22 G23 N24 Y26 F29 R45 S49 K56 W65 R67 F69 H71 K74 T75 K76 K77 L79 E80 R82 M83 G84 S85 G86 K87 G88 K98 R120 H123 K124 L125 P126 T128 W129	P4 K5 R6 T7 K8 Y9 R10 K11 P12 H13 N14 K20 K22 G23 N24 Y26 F29 R45 S49 K56 W65 R67 F69 H71 K74 T75 K76 K77 L79 E80 R82 M83 G84 S85 G86 K87 G88 K98 R120 H123 K124 L125 P126 T128 W129

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7pir, PDBe:7pir, PDBj:7pir
PDBsum	7pir
PubMed	36171285
UniProt	P41204\|RL16_MYCPN Large ribosomal subunit protein uL16 (Gene Name=rplP)