Structure of PDB 7par Chain l

Receptor sequence

>7parl (length=136) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]

MLQPKRTKYRKPHNVSYEGKAKGNSYVAFGEYGLVATKGNWIDARAIESA
RIAISKCLGKTGKMWIRIFPHMSKTKKPLEVRMGSGKGNPEFWVAVVKQG
TVMFEVANIPESQMIKALTRAGHKLPVTWKILKREE

3D structure

PDB

7par Visualizing translation dynamics at atomic detail inside a bacterial cell.

Chain

Resolution

8.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	l	P4 K5 R6 K8 Y9 K11 P12 H13 N14 Y17 K22 G23 N24 Y26 F29 W41 R45 K56 R67 F69 H71 T75 K76 K77 V81 R82 M83 G84 S85 G86 K87 G88 R120 H123 K124 P126 T128	P4 K5 R6 K8 Y9 K11 P12 H13 N14 Y17 K22 G23 N24 Y26 F29 W41 R45 K56 R67 F69 H71 T75 K76 K77 V81 R82 M83 G84 S85 G86 K87 G88 R120 H123 K124 P126 T128

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7par, PDBe:7par, PDBj:7par
PDBsum	7par
PubMed	36171285
UniProt	P41204\|RL16_MYCPN Large ribosomal subunit protein uL16 (Gene Name=rplP)