Structure of PDB 7oui Chain l

Receptor sequence
>7ouil (length=36) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
QSNPNEQSVELNRTSLYWGLLLIFVLAVLFSNYFFN
3D structure
PDB7oui High-resolution model of Arabidopsis Photosystem II reveals the structural consequences of digitonin-extraction.
Chainl
Resolution2.79 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide l R15 Y19 F26 F37 R13 Y17 F24 F35
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009534 chloroplast thylakoid
GO:0009535 chloroplast thylakoid membrane
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oui, PDBe:7oui, PDBj:7oui
PDBsum7oui
PubMed34330992
UniProtP60129|PSBL_ARATH Photosystem II reaction center protein L (Gene Name=psbL)

[Back to BioLiP]