Structure of PDB 7oii Chain l

Receptor sequence

>7oiil (length=129) Species: 562 (Escherichia coli)

SMQDPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKV
EGDTKPELELTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGI
AVVSTSKGVMTDRAARQAGLGGEIICYVA

3D structure

• PDB: 7oii A switch from alpha-helical to beta-strand conformation during co-translational protein folding.
• Chain: l
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	l	S2 M3 Q4 D9 T12 R13 R15 N16 S30 K31 R80 P81 R84 Y86 R88 K89 S105 T106 S107 K108 G122 E124	S1 M2 Q3 D8 T11 R12 R14 N15 S29 K30 R79 P80 R83 Y85 R87 K88 S104 T105 S106 K107 G121 E123

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Nov 17 23:32:19 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7oii', asym_id = 'l', title = 'A switch from alpha-helical to beta-strand conformation during co-translational protein folding.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7oii', asym_id='l', title='A switch from alpha-helical to beta-strand conformation during co-translational protein folding.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '7oii', asym_id = 'l'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='7oii', asym_id='l')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>