Structure of PDB 7o5b Chain l

Receptor sequence
>7o5bl (length=120) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
MITKTSKNAARLKRHARVRAKLSGTAERPRLNVFRSNKHIYAQIIDDVNG
VTLASASTLDKDLNVESTGDTSAATKVGELVAKRAAEKGISDVVFDRGGY
LYHGRVKALADAAREAGLKF
3D structure
PDB7o5b Inhibition of SRP-dependent protein secretion by the bacterial alarmone (p)ppGpp.
Chainl
Resolution3.33 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna l T3 R14 R17 K21 F95 R97 Y102 R114 F120 T3 R14 R17 K21 F95 R97 Y102 R114 F120
BS02 rna l S6 K7 R11 R19 N32 F34 R35 S36 N37 K38 H39 Q43 G50 T52 K61 D70 Y100 L101 H103 R105 S6 K7 R11 R19 N32 F34 R35 S36 N37 K38 H39 Q43 G50 T52 K61 D70 Y100 L101 H103 R105
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006364 rRNA processing
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7o5b, PDBe:7o5b, PDBj:7o5b
PDBsum7o5b
PubMed35217658
UniProtP46899|RL18_BACSU Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]