Structure of PDB 7nhn Chain l

Receptor sequence
>7nhnl (length=114) Species: 169963 (Listeria monocytogenes EGD-e) [Search protein sequence]
IESGIAHIRSTFNNTIVMITDTHGNALAWSSAGSLGFKGSRKSTPFAAQM
AAESAAKSAQEHGLKTLEVTVKGPGSGREAAIRALQAAGLEVTAIKDVTP
VPHNGCRPPKRRRV
3D structure
PDB7nhn Structural basis of ABCF-mediated resistance to pleuromutilin, lincosamide, and streptogramin A antibiotics in Gram-positive pathogens.
Chainl
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna l H22 N28 N29 M33 G39 N40 A41 W44 S46 G48 S49 G54 S55 K57 V116 P117 H118 N119 G120 C121 P124 K125 R127 R128 V129 H7 N13 N14 M18 G24 N25 A26 W29 S31 G33 S34 G39 S40 K42 V101 P102 H103 N104 G105 C106 P109 K110 R112 R113 V114
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nhn, PDBe:7nhn, PDBj:7nhn
PDBsum7nhn
PubMed34117249
UniProtP66352|RS11_LISMO Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]