Structure of PDB 7nhm Chain l

Receptor sequence
>7nhml (length=118) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
VKKNIENGVAHIRSTFNNTIVTITDEFGNALSWSSAGALGFKGSKKSTPF
AAQMASETASKSAMEHGLKTVEVTVKGPGPGRESAIRALQSAGLEVTAIR
DVTPVPHNGCRPPKRRRV
3D structure
PDB7nhm Structural basis of ABCF-mediated resistance to pleuromutilin, lincosamide, and streptogramin A antibiotics in Gram-positive pathogens.
Chainl
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna l K14 H22 N28 N29 G39 N40 A41 W44 G48 A49 G54 S55 K57 K87 P115 H118 N119 C121 R122 P124 K125 R127 R128 K3 H11 N17 N18 G28 N29 A30 W33 G37 A38 G43 S44 K46 K76 P104 H107 N108 C110 R111 P113 K114 R116 R117
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nhm, PDBe:7nhm, PDBj:7nhm
PDBsum7nhm
PubMed34117249
UniProtQ2FW31|RS11_STAA8 Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]