Structure of PDB 7l20 Chain l |
>7l20l (length=72) Species: 9606 (Homo sapiens) [Search protein sequence] |
VQLTTYAMGVNIYKEGQDVPLKPDAEYPEWLFEMNLGPPKTLEELDPESR EYWRRLRKQNIWRHNRLSKNKR |
|
PDB | 7l20 Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance. |
Chain | l |
Resolution | 3.15 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
l |
K123 I126 H129 N130 |
K58 I61 H64 N65 |
|
|
|
|