Structure of PDB 6ylx Chain l

Receptor sequence
>6ylxl (length=50) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
AAQKSFRIKQKMAKAKKQNRPLPQWIRLRTNNTIRYNAKRRNWRRTKMNI
3D structure
PDB6ylx Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
Chainl
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna l A2 A3 Q4 K10 M13 P22 T34 I35 R36 Y37 N38 A39 K40 W44 R45 K48 M49 A1 A2 Q3 K9 M12 P21 T33 I34 R35 Y36 N37 A38 K39 W43 R44 K47 M48
BS02 rna l S6 F7 R8 Q11 Q19 R21 L23 W26 I27 L29 R30 T31 S5 F6 R7 Q10 Q18 R20 L22 W25 I26 L28 R29 T30
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ylx, PDBe:6ylx, PDBj:6ylx
PDBsum6ylx
PubMed32668200
UniProtP04650|RL39_YEAST Large ribosomal subunit protein eL39 (Gene Name=RPL39)

[Back to BioLiP]