Structure of PDB 6vpv Chain l

Receptor sequence

>6vpvl (length=160) Species: 2676140 (Cyanobacterium aponinum 0216) [Search protein sequence]

IDVVNHGGDPQVGNLSTPINGSAFTKAFINALPAYRKGLSPNRRGLEVGM
AHGYLLYGPFAVLGPLRLTEYGPTAGLLATIGLVSILTICLSIYGAVGVS
KPTETLTTPEVPMDLATKEGWSEFAGGFLLGGCGGAFFAFFLCQTPHLQP
LIEVASNIWS

3D structure

PDB

6vpv The structure of photosystem I from a high-light tolerant Cyanobacteria.

Chain

Resolution

2.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	l	T91 I92 S95 L132	T88 I89 S92 L129
BS02	CLA	l	V7 T20 P21 I22	V4 T17 P18 I19
BS03	CLA	l	P62 F63 L66	P59 F60 L63
BS04	CLA	l	P68 L69 L81 G85	P65 L66 L78 G82
BS05	CLA	l	I89 Y97	I86 Y94
BS06	CLA	l	I92 C93	I89 C90
BS07	CLA	l	T20 I22 N23 T28	T17 I19 N20 T25
BS08	CLA	l	F31 A34 L35 R39 R46 E50 M53	F28 A31 L32 R36 R43 E47 M50
BS09	CLA	l	Y57 G61 L154 V157	Y54 G58 L151 V154
BS10	CLA	l	L35 P36 V51 H55 L58	L32 P33 V48 H52 L55

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009522	photosystem I
GO:0009538	photosystem I reaction center
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane
GO:0042651	thylakoid membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6vpv, PDBe:6vpv, PDBj:6vpv
PDBsum	6vpv
PubMed	34435952
UniProt	K9Z7Y0

[Back to BioLiP]