Structure of PDB 6v3a Chain l

Receptor sequence

>6v3al (length=122) Species: 480119 (Acinetobacter baumannii AB0057)

ATTNQLIRKGRTTLVEKSKVPALKACPQRRGVCTRVYTTTPKKPNSAMRK
VCRVRLTSGFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGS
LDCAGVKDRNQSRSKYGAKRPK

3D structure

• PDB: 6v3a Cryo-electron Microscopy Structure of the Acinetobacter baumannii 70S Ribosome and Implications for New Antibiotic Development.
• Chain: l
• Resolution: 2.82 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	l	N5 Q6 L7 R9 R12 T13 K18 C27 P28 Q29 R31 N46 S47 A48 M49 R50 E70 G84 V87 K88 D89 R110 N111 Q112 S113 R114 S115 K116 A119 K120 R121	N4 Q5 L6 R8 R11 T12 K17 C26 P27 Q28 R30 N45 S46 A47 M48 R49 E69 G83 V86 K87 D88 R109 N110 Q111 S112 R113 S114 K115 A118 K119 R120

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6v3a, PDBe:6v3a, PDBj:6v3a
• PDBsum: 6v3a
• PubMed: 31964740
• UniProt: B7I7R9|RS12_ACIB5 Small ribosomal subunit protein uS12 (Gene Name=rpsL)