Structure of PDB 6trd Chain l

Receptor sequence
>6trdl (length=152) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
ELVKPYNGDPFVGHLSTPISDSGLVKTFIGNLPAYRQGLSPILRGLEVGM
AHGYFLIGPWVKLGPLRDSDVANLGGLISGIALILVATACLAAYGLVSFQ
KGGSSSDPLKTSEGWSQFTAGFFVGAMGSAFVAFFLLENFLVVDGIMTGL
FN
3D structure
PDB6trd Current limits of structural biology: The transient interaction between cytochrome c6 and photosystem I
Chainl
Resolution3.16 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA l V5 T19 V3 T17
BS02 CLA l I21 V27 I19 V25
BS03 CLA l P61 W62 L65 P67 P59 W60 L63 P65
BS04 CLA l I80 S81 I78 S79
BS05 CA l P67 D70 P65 D68
BS06 CLA l F30 N33 R38 E49 M52 F28 N31 R36 E47 M50
BS07 CLA l P35 A36 H54 F57 P33 A34 H52 F55
BS08 CLA l Y56 F57 G60 K64 L139 F142 Y54 F55 G58 K62 L137 F140
BS09 CLA l A91 A94 A89 A92
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009538 photosystem I reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6trd, PDBe:6trd, PDBj:6trd
PDBsum6trd
PubMed
UniProtQ8DGB4|PSAL_THEVB Photosystem I reaction center subunit XI (Gene Name=psaL)

[Back to BioLiP]