Structure of PDB 6tnn Chain l

Receptor sequence

>6tnnl (length=109) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

QAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTPRAASPIIEKVL
KSAIANAEHNYEMDANNLVISQAFVDEGPTLKRFRPRAMGRASQINKRTS
HITIVVSEK

3D structure

• PDB: 6tnn Structures of B. subtilis Maturation RNases Captured on 50S Ribosome with Pre-rRNAs.
• Chain: l
• Resolution: 3.07 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	l	V6 R8 R11 R15 K16 R18 R25 R41 A42 A56 N57 N61 D77 E78 K83 P87 R88 A89 M90 G91 R92 S94	V5 R7 R10 R14 K15 R17 R24 R40 A41 A55 N56 N60 D76 E77 K82 P86 R87 A88 M89 G90 R91 S93

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6tnn, PDBe:6tnn, PDBj:6tnn
• PDBsum: 6tnn
• PubMed: 32991829
• UniProt: P42060|RL22_BACSU Large ribosomal subunit protein uL22 (Gene Name=rplV)