Structure of PDB 6spe Chain l

Receptor sequence

>6spel (length=121) Species: 287 (Pseudomonas aeruginosa)

ATINQLVRKPRKRMVDKSDVPALQNCPQRRGVCTRVYTTTPKKPNSALRK
VCRVRLTNGFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGS
LDTSGVKDRKQGRSKYGAKRP

3D structure

• PDB: 6spe Structure ofPseudomonas aeruginosaribosomes from an aminoglycoside-resistant clinical isolate.
• Chain: l
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	l	A2 N5 Q6 R9 R12 K13 R14 M15 S19 C27 P28 Q29 R30 R31 K44 N46 S47 R50 K51 G69 E70 K88 R94 R110 K111 Q112 G113 R114 S115 A119 K120 R121	A1 N4 Q5 R8 R11 K12 R13 M14 S18 C26 P27 Q28 R29 R30 K43 N45 S46 R49 K50 G68 E69 K87 R93 R109 K110 Q111 G112 R113 S114 A118 K119 R120

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6spe, PDBe:6spe, PDBj:6spe
• PDBsum: 6spe
• PubMed: 31611393
• UniProt: A0A071L394