Structure of PDB 6snt Chain l

Receptor sequence

>6sntl (length=167) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

TAQQAPKWYPSEDVAAPKKTRKAVRPQKLRASLVPGTVLILLAGRFRGKR
VVYLKHLEDNTLLVTGPFKVNGVPLRRVNARYVIATSTKVSVEGVNVEKF
NVEYFAKEKLTAAAAAAAAEIKAERVEDQKVVDKALIAEIKKTPLLKQYL
SASFSLKNGDKPHMLKF

3D structure

PDB

6snt RQT complex dissociates ribosomes collided on endogenous RQC substrate SDD1.

Chain

Resolution

2.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	l	T2 A3 Q5 W9 A17 P18 K19 K20 R22 K23 A24 R26 Q28 G45 R46 R48 N61 T62 F69 K70 V71 N72 G73 P75 R77 R78 N80 R82 Y83 K108 Q157 A161 S162 N167 M173	T1 A2 Q4 W8 A16 P17 K18 K19 R21 K22 A23 R25 Q27 G44 R45 R47 N60 T61 F68 K69 V70 N71 G72 P74 R76 R77 N79 R81 Y82 K107 Q148 A152 S153 N158 M164

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6snt, PDBe:6snt, PDBj:6snt
PDBsum	6snt
PubMed	32203490
UniProt	P05739\|RL6B_YEAST Large ribosomal subunit protein eL6B (Gene Name=RPL6B)

[Back to BioLiP]