Structure of PDB 6r87 Chain l

Receptor sequence

>6r87l (length=87) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

GKGTPSFGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPAAKTRSYNWGA
KAKRRHTTGTGRMRYLKHVSRRFKNGFQTGSASKASA

3D structure

PDB

6r87 Structure and function of Vms1 and Arb1 in RQC and mitochondrial proteome homeostasis.

Chain

Resolution

3.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	l	R21 C22 V29 Y39 T59 G62 R63 M64 Y66 L67 S71 R72 F74 K75 N76 Q79 G81 S82 S84 K85 A86 S87 A88	R20 C21 V28 Y38 T58 G61 R62 M63 Y65 L66 S70 R71 F73 K74 N75 Q78 G80 S81 S83 K84 A85 S86 A87
BS02	rna	l	G2 K3 G4 T5 P6 F8 G9 K10 R11 H12 N13 K14 S15 H16 R24 R25 S26 H28 Q30 K31 S35 A42 K43 T44 R45 Y47 N48 W49 K52 R55 R56 K75	G1 K2 G3 T4 P5 F7 G8 K9 R10 H11 N12 K13 S14 H15 R23 R24 S25 H27 Q29 K30 S34 A41 K42 T43 R44 Y46 N47 W48 K51 R54 R55 K74

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0008270	zinc ion binding
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0000448	cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0030687	preribosome, large subunit precursor
GO:0044391	ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6r87, PDBe:6r87, PDBj:6r87
PDBsum	6r87
PubMed	31189955
UniProt	P49166\|RL37A_YEAST Large ribosomal subunit protein eL37A (Gene Name=RPL37A)