Structure of PDB 6n8m Chain l

Receptor sequence

>6n8ml (length=125) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

AKQSLDVSSDRRKARKAYFTAPSSQRRVLLSAPLSKELRAQYGIKALPIR
RDDEVLVVRGSKKGQEGKISSVYRLKFAVQVDKVTKEKVNGASVPINLHP
SKLVITKLHLDKDRKALIQRKGGKL

3D structure

PDB

6n8m Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.

Chain

Resolution

3.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	l	A2 Q4 S5 L6 S9 S10 R12 A15 R16 Y19 V29 L30 S32 K46 A47 R60 S62 K87 N91 S102 K103 R121	A1 Q3 S4 L5 S8 S9 R11 A14 R15 Y18 V28 L29 S31 K45 A46 R59 S61 K86 N90 S101 K102 R120
BS02	rna	l	R13 R16 F20 S25 R28 R51 R52 Y74 R75 L111 D112 D114	R12 R15 F19 S24 R27 R50 R51 Y73 R74 L110 D111 D113

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:0032991	protein-containing complex
GO:0043232	intracellular non-membrane-bounded organelle
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6n8m, PDBe:6n8m, PDBj:6n8m
PDBsum	6n8m
PubMed	30814529
UniProt	P05743\|RL26A_YEAST Large ribosomal subunit protein uL24A (Gene Name=RPL26A)