Structure of PDB 5xjc Chain l |
>5xjcl (length=79) Species: 9606 (Homo sapiens) [Search protein sequence] |
MVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEE IHSKTKSRKQLGRIMLKGDNITLLQSVSN |
|
PDB | 5xjc An Atomic Structure of the Human Spliceosome |
Chain | l |
Resolution | 3.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
l |
Y36 Y53 N55 K80 |
Y23 Y40 N42 K67 |
|
|
|
|