Structure of PDB 5tbw Chain l

Receptor sequence

>5tbwl (length=361) Species: 559292 (Saccharomyces cerevisiae S288C)

SRPQVTVHSLTGEATANALPLPAVFSAPIRPDIVHTVFTSVNKNKRQAYA
VSEKAGHQTSAESWGTGRAVARIPRVGGGGTGRSGQGAFGNMCRGGRMFA
PTKTWRKWNVKVNHNEKRYATASAIAATAVASLVLARGHRVEKIPEIPLV
VSTDLESIQKTKEAVAALKAVGAHSDLLKVLKSKKLRAGKGKYRNRRWTQ
RRGPLVVYAEDNGIVKALRNVPGVETANVASLNLLQLAPGAHLGRFVIWT
EAAFTKLDQVWGSETVASSKVGYTLPSHIISTSDVTRIINSSEIQSAIRP
AGQATQKRTHVLKKNPLKNKQVLLRLNPYAKVFAAEKLGSKKAEKTGTKP
AAVFTETLKHD

3D structure

• PDB: 5tbw Synthesis facilitates an understanding of the structural basis for translation inhibition by the lissoclimides.
• Chain: l
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	l	R31 H36 N43 K44 N45 K46 R47 Q48 Y50 V52 S53 E54 A56 H58 Q59 S61 T67 G68 A70 V71 A72 R73 I74 P75 G80 G81 T82 R84 Q87 G88 N92 M93 C94 R95 G96 R98 M99 F100 K104 W106 R107 K108 K112 N114 H115 N116 E117 K118 R119 R138 G139 R141 K161 T162 K163 L179 K180 K183 S184 K186 L187 R188 A189 G190 K191 Y194 R195 R197 W199 R202 R203 Y209 V216 K217 R220 N221 T227 S232 N234 P240 G241 H243 K271 V272 T287 N291 R300 A302 G303 A305 Q307 K308 R309 V312 L313 K315 K319 N320 Q322 R326 A331 K332 F334 A335 S341 K342 K343 T347 T349 P351 F355 L359	R30 H35 N42 K43 N44 K45 R46 Q47 Y49 V51 S52 E53 A55 H57 Q58 S60 T66 G67 A69 V70 A71 R72 I73 P74 G79 G80 T81 R83 Q86 G87 N91 M92 C93 R94 G95 R97 M98 F99 K103 W105 R106 K107 K111 N113 H114 N115 E116 K117 R118 R137 G138 R140 K160 T161 K162 L178 K179 K182 S183 K185 L186 R187 A188 G189 K190 Y193 R194 R196 W198 R201 R202 Y208 V215 K216 R219 N220 T226 S231 N233 P239 G240 H242 K270 V271 T286 N290 R299 A301 G302 A304 Q306 K307 R308 V311 L312 K314 K318 N319 Q321 R325 A330 K331 F333 A334 S340 K341 K342 T346 T348 P350 F354 L358
BS02	rna	l	A49 A51 S53 K193 Y194	A48 A50 S52 K192 Y193
BS03	MG	l	G190 K191 G192	G189 K190 G191
BS04	OHX	l	E143 I145 P146	E142 I144 P145

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5tbw, PDBe:5tbw, PDBj:5tbw
• PDBsum: 5tbw
• PubMed: 29064494
• UniProt: P10664|RL4A_YEAST Large ribosomal subunit protein uL4A (Gene Name=RPL4A)