Structure of PDB 5t61 Chain l

Receptor sequence

>5t61l (length=428) Species: 866790 (Methanothermobacter sp. CaT2)

MEYVKNVVCPFCGTLCDDIICKVEGNEIVGTINACRIGHSKFVHAEGAMR
YKKPLIRKEFVEVSYDEAIDKAAKILAESKRPLMYGWSCTECEAQAVGVE
LAEEAGAVIDNTASVCHGPSVLALQDVGYPICTFGEVKNRADVVVYWGCN
PMHAHPRHMSRNVFARGFFRERGRSDRTLIVVDPRKTDSAKLADIHLQLD
FDRDYELLDAMRACLLGHEILYDEVAGVPREQIEEAVEVLKNAQFGILFF
GMGITHSRGKHRNIDTAIMMVQDLNDYAKWTLIPMRGHYNVTGFNQVCTW
ESGYPYCVDFSGGEPRYNPGETGANDLLQNREADAMMVIASDPGAHFPQR
ALERMAEIPVIAIEPHRTPTTEMADIIIPPAIVGMEAEGTAYRMEGVPIR
MKKVVDSDLLSDREILERLLEKVREYKA

3D structure

• PDB: 5t61 The methanogenic CO2 reducing-and-fixing enzyme is bifunctional and contains 46 [4Fe-4S] clusters.
• Chain: l
• Resolution: 2.55 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	l	C9 C12 T14 C16 C35 R159	C9 C12 T14 C16 C35 R157
BS02	MGD	l	K41 C91 V117 C118 H258 H290 A342 S343 D344 H348 E366 P367 P382 I384 V385 D414	K41 C89 V115 C116 H256 H288 A340 S341 D342 H346 E364 P365 P380 I382 V383 D412
BS03	MGD	l	F11 G150 C151 A156 D185 P186 R187 D206 G253 M254 G255 S259 G289 H290	F11 G148 C149 A154 D183 P184 R185 D204 G251 M252 G253 S257 G287 H288

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 29 20:12:12 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5t61', asym_id = 'l', title = 'The methanogenic CO2 reducing-and-fixing enzyme is bifunctional and contains 46 [4Fe-4S] clusters.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5t61', asym_id='l', title='The methanogenic CO2 reducing-and-fixing enzyme is bifunctional and contains 46 [4Fe-4S] clusters.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0015948,0016491,0018493', uniprot = '', pdbid = '5t61', asym_id = 'l'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0015948,0016491,0018493', uniprot='', pdbid='5t61', asym_id='l')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>