Structure of PDB 5t5h Chain l

Receptor sequence

>5t5hl (length=136) Species: 5693 (Trypanosoma cruzi) [Search protein sequence]

NRSKKIQQLTKKTSTVKRNRKSPRLYMKAVLAGYTRGLHGQNKNTAIVRI
ENVNTKEDAAWYVGKRVCYVYHGYKMKRCVRWSKAPARRSNTRAIWGRVT
RPHGGSGAVRAKFNGSAVPASAIGKRVRVYLYPSRI

3D structure

PDB

5t5h Structure and assembly model for the Trypanosoma cruzi 60S ribosomal subunit.

Chain

Resolution

2.54 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	l	R49 G50 L51 H52 Q54 K56 R62 N67 K69 R79 Y84 Y87 K88 K90 R91 V93 R94 S96 K97 R106 R111 R114 H116 G117 G118 S119 R123 K125 A130 P132 A133 S134 R148	R36 G37 L38 H39 Q41 K43 R49 N54 K56 R66 Y71 Y74 K75 K77 R78 V80 R81 S83 K84 R93 R98 R101 H103 G104 G105 S106 R110 K112 A117 P119 A120 S121 R135
BS02	rna	l	H85 Y87	H72 Y74
BS03	rna	l	T28 V29 K30 R31 N32 R33 K34 S35 P36 R37 Y39 K41 R79 V83 Y84 H85 C92 V93 R94 A98 A100 R101 S103 N104 T105 A107 W109 R139 R141 Y143 Y145	T15 V16 K17 R18 N19 R20 K21 S22 P23 R24 Y26 K28 R66 V70 Y71 H72 C79 V80 R81 A85 A87 R88 S90 N91 T92 A94 W96 R126 R128 Y130 Y132

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit

External links