Structure of PDB 5t2a Chain l

Receptor sequence

>5t2al (length=81) Species: 5661 (Leishmania donovani)

TKGTTSMGQRHGRTHILCRRCGRNSYHVQWERCAACAYPRASRRRYNWSV
KAIKRRRTGTGRCRYLKVVNRRIANHFKTPK

3D structure

• PDB: 5t2a Structures and stabilization of kinetoplastid-specific split rRNAs revealed by comparing leishmanial and human ribosomes.
• Chain: l
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	l	T2 K3 G4 T5 T6 S7 M8 Q10 R11 H12 G13 R14 T15 H16 R24 H28 Q30 R33 A35 R41 A42 S43 R44 R45 R46 Y47 N48 W49 S50 V51 K52 K55 R56 R57 R58 T59 K79 T80	T1 K2 G3 T4 T5 S6 M7 Q9 R10 H11 G12 R13 T14 H15 R23 H27 Q29 R32 A34 R40 A41 S42 R43 R44 R45 Y46 N47 W48 S49 V50 K51 K54 R55 R56 R57 T58 K78 T79
BS02	rna	l	T2 K3 T5 T6 M8 G9 Q10 H12	T1 K2 T4 T5 M7 G8 Q9 H11
BS03	rna	l	R20 R21 G23 A42 R44 T59 T61 G62 R63 C64 Y66 R72 R73 N76 H77 K79 T80 P81	R19 R20 G22 A41 R43 T58 T60 G61 R62 C63 Y65 R71 R72 N75 H76 K78 T79 P80

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5t2a, PDBe:5t2a, PDBj:5t2a
• PDBsum: 5t2a
• PubMed: 27752045
• UniProt: P62885|RL37_LEIDO Large ribosomal subunit protein eL37 (Gene Name=RPL37)