Structure of PDB 5lzu Chain l

Receptor sequence
>5lzul (length=50) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
SSHKTFRIKRFLAKKQKQNRPIPQWIWMKTGNKIRYNSKRRHWRRTKLGL
3D structure
PDB5lzu Decoding Mammalian Ribosome-mRNA States by Translational GTPase Complexes.
Chainl
Resolution3.75 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna l S2 S3 H4 K5 K10 L13 Q17 R36 Y37 S39 K40 R41 R42 H43 W44 R45 K48 L49 L51 S1 S2 H3 K4 K9 L12 Q16 R35 Y36 S38 K39 R40 R41 H42 W43 R44 K47 L48 L50
BS02 rna l T6 F7 K15 K18 Q19 I23 W26 M29 K30 T31 I35 N38 K40 T5 F6 K14 K17 Q18 I22 W25 M28 K29 T30 I34 N37 K39
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5lzu, PDBe:5lzu, PDBj:5lzu
PDBsum5lzu
PubMed27863242
UniProtG1TTN1

[Back to BioLiP]