Structure of PDB 5jcs Chain l

Receptor sequence
>5jcsl (length=50) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
AAQKSFRIKQKMAKAKKQNRPLPQWIRLRTNNTIRYNAKRRNWRRTKMNI
3D structure
PDB5jcs Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
Chainl
Resolution9.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna l A2 A3 Q4 S6 M13 K17 N20 R21 K48 M49 A1 A2 Q3 S5 M12 K16 N19 R20 K47 M48
BS02 rna l F7 Q11 A14 K18 Q19 R21 F6 Q10 A13 K17 Q18 R20
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5jcs, PDBe:5jcs, PDBj:5jcs
PDBsum5jcs
PubMed26619264
UniProtP04650|RL39_YEAST Large ribosomal subunit protein eL39 (Gene Name=RPL39)

[Back to BioLiP]