Structure of PDB 5gad Chain l

Receptor sequence

>5gadl (length=198) Species: 562 (Escherichia coli)

LNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAA
AVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKARNIDVLIADTAG
RLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLFH
EAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPF

3D structure

• PDB: 5gad Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
• Chain: l
• Resolution: 3.7 Å

Enzymatic activity

• Enzyme Commision number: 3.6.5.4: signal-recognition-particle GTPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	l	D359 A361 S362 F365 D366 K399 R402 V403 K406	D74 A76 S77 F80 D81 K114 R117 V118 K121
BS02	GNP	l	N302 R333	N17 R48
BS03	GNP	l	N302 G303 G305 K306 T307 T308 K312 R333 G385 K447 D449 G472 G474 E475	N17 G18 G20 K21 T22 T23 K27 R48 G100 K162 D164 G187 G189 E190

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0005047 signal recognition particle binding
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0016787 hydrolase activity
• GO:0016887 ATP hydrolysis activity
• GO:0042803 protein homodimerization activity

Biological Process

• GO:0006605 protein targeting
• GO:0006612 protein targeting to membrane
• GO:0006614 SRP-dependent cotranslational protein targeting to membrane
• GO:0015968 stringent response

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005886 plasma membrane
• GO:0009898 cytoplasmic side of plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:5gad, PDBe:5gad, PDBj:5gad
• PDBsum: 5gad
• PubMed: 26804923
• UniProt: P10121|FTSY_ECOLI Signal recognition particle receptor FtsY (Gene Name=ftsY)