Structure of PDB 3jb9 Chain l

Receptor sequence

>3jb9l (length=87) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence]

RLEEYEFSAGPLSVLQQAVKNHDQVLINCRNNKKLLARVKAFDRHSNMVL
ENVKEMWTEKAINKDRFISKMFLRGDGVVLVVRIPSA

3D structure

PDB

3jb9 Structure of a yeast spliceosome at 3.6-angstrom resolution

Chain

Resolution

3.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	l	R48 R62 H63 N65 R102 D104 G105	R30 R44 H45 N47 R74 D76 G77

Gene Ontology

	Molecular Function
GO:0003723	RNA binding

	Biological Process
GO:0000387	spliceosomal snRNP assembly
GO:0000395	mRNA 5'-splice site recognition
GO:0000398	mRNA splicing, via spliceosome
GO:0006397	mRNA processing
GO:0008380	RNA splicing

	Cellular Component
GO:0000974	Prp19 complex
GO:0005634	nucleus
GO:0005681	spliceosomal complex
GO:0005682	U5 snRNP
GO:0005685	U1 snRNP
GO:0005686	U2 snRNP
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0030532	small nuclear ribonucleoprotein complex
GO:0032991	protein-containing complex
GO:0034715	pICln-Sm protein complex
GO:0046540	U4/U6 x U5 tri-snRNP complex
GO:0071004	U2-type prespliceosome
GO:0071011	precatalytic spliceosome
GO:0071013	catalytic step 2 spliceosome
GO:0071014	post-mRNA release spliceosomal complex
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:3jb9, PDBe:3jb9, PDBj:3jb9
PDBsum	3jb9
PubMed	26292707
UniProt	O14036\|SMD2_SCHPO Small nuclear ribonucleoprotein Sm D2 (Gene Name=smd2)