Structure of PDB 3jap Chain l

Receptor sequence
>3japl (length=128) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
VGLPYSELLSRFFNILRKFRIPPPVCLRDGKKTIFSNIQDIAEKLHRSPE
HLIQYLFAELGTSGSVDGKRLVIKGKFQSKQMENVLRRYILEYVTCKTCK
SINTELKRENRLFFMVCKSCGSTRSVSS
3D structure
PDB3jap Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
Chainl
Resolution4.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna l K170 S202 R248 N252 R253 F255 K31 S63 R108 N110 R111 F113
BS02 rna l D168 G169 K170 D29 G30 K31
BS03 ZN l C236 S264 C96 S122
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003743 translation initiation factor activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0008270 zinc ion binding
GO:0031369 translation initiation factor binding
GO:0046872 metal ion binding
GO:1990856 methionyl-initiator methionine tRNA binding
Biological Process
GO:0001731 formation of translation preinitiation complex
GO:0006412 translation
GO:0006413 translational initiation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005850 eukaryotic translation initiation factor 2 complex
GO:0016282 eukaryotic 43S preinitiation complex
GO:0043614 multi-eIF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jap, PDBe:3jap, PDBj:3jap
PDBsum3jap
PubMed26212456
UniProtP09064|IF2B_YEAST Eukaryotic translation initiation factor 2 subunit beta (Gene Name=SUI3)

[Back to BioLiP]