Structure of PDB 5y6p Chain kT

Receptor sequence
>5y6pkT (length=146) Species: 35689 (Griffithsia pacifica) [Search protein sequence]
SDGNKRLDAVNCIVSNASCIVSDAISGMICENPGLIAPGGNCYTNRRMAA
CLRDGEIILRYVSYALLAGDSSVLDDRCLNGLKETYIALGVPTASTSRAV
SIMKAASTAFIMNTASGRKIEIAAGDCQALQSEAAAYFDKVGSAVD
3D structure
PDB5y6p Structure of phycobilisome from the red alga Griffithsia pacifica
ChainkT
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 PEB kT P69 G70 P38 G39
BS02 PEB kT R78 A81 C82 R84 D85 I88 L120 R47 A50 C51 R53 D54 I57 L89
BS03 PEB kT D33 N35 K36 D39 N42 I142 N144 I153 A154 A155 G156 D2 N4 K5 D8 N11 I111 N113 I122 A123 A124 G125
BS04 PUB kT D54 S57 C61 A146 S147 D23 S26 C30 A115 S116
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sun Nov 24 22:45:21 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5y6p', asym_id = 'kT', title = 'Structure of phycobilisome from the red alga Griffithsia pacifica'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5y6p', asym_id='kT', title='Structure of phycobilisome from the red alga Griffithsia pacifica')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0015979,0030089', uniprot = '', pdbid = '5y6p', asym_id = 'kT'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0015979,0030089', uniprot='', pdbid='5y6p', asym_id='kT')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>