Structure of PDB 5vyc Chain k1

Receptor sequence
>5vyck1 (length=181) Species: 9606 (Homo sapiens) [Search protein sequence]
MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPV
KIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKG
AIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKM
SAEDIEKVNKGIGIENIHYLNDGLWHMKTYK
3D structure
PDB5vyc Crystal Structure of the Human Ribosome in Complex with DENR-MCT-1.
Chaink1
Resolution6.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna k1 I15 Q16 L17 K18 T19 S20 K23 K46 I15 Q16 L17 K18 T19 S20 K23 K46
BS02 rna k1 A109 N110 I111 A109 N110 I111
Gene Ontology
Molecular Function
GO:0000339 RNA cap binding
GO:0003723 RNA binding
GO:0003743 translation initiation factor activity
GO:0005515 protein binding
GO:0043024 ribosomal small subunit binding
GO:0045183 translation factor activity, non-nucleic acid binding
Biological Process
GO:0001731 formation of translation preinitiation complex
GO:0002188 translation reinitiation
GO:0006412 translation
GO:0006413 translational initiation
GO:0006417 regulation of translation
GO:0006974 DNA damage response
GO:0032790 ribosome disassembly
GO:0075522 IRES-dependent viral translational initiation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5vyc, PDBe:5vyc, PDBj:5vyc
PDBsum5vyc
PubMed28723557
UniProtQ9ULC4|MCTS1_HUMAN Malignant T-cell-amplified sequence 1 (Gene Name=MCTS1)

[Back to BioLiP]