Structure of PDB 4yuu Chain k1

Receptor sequence
>4yuuk1 (length=37) Species: 2771 (Cyanidium caldarium) [Search protein sequence]
QLPETYNIFAPIIDIMPVIPILFLLLAFVWQAAVGFR
3D structure
PDB4yuu Novel Features of Eukaryotic Photosystem II Revealed by Its Crystal Structure Analysis from a Red Alga
Chaink1
Resolution2.77 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide k1 D23 I24 D14 I15
BS02 CLA k1 P29 L33 P20 L24
BS03 CLA k1 W39 Q40 W30 Q31
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4yuu, PDBe:4yuu, PDBj:4yuu
PDBsum4yuu
PubMed26757821
UniProtQ9TLR0|PSBK_CYACA Photosystem II reaction center protein K (Gene Name=psbK)

[Back to BioLiP]