Structure of PDB 8wid Chain k

Receptor sequence
>8widk (length=98) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
QKIRIRLKAYDHEAIDASARKIVETVTRTGASVVGPVPLPTEKNVYCVIR
SPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNIQ
3D structure
PDB8wid Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
Chaink
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna k R7 R9 H15 V37 V40 P41 L42 P43 T44 E45 N47 R53 S54 P55 H56 K57 Y58 K59 S61 R62 H64 H70 R72 L73 R4 R6 H12 V34 V37 P38 L39 P40 T41 E42 N44 R50 S51 P52 H53 K54 Y55 K56 S58 R59 H61 H67 R69 L70
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wid, PDBe:8wid, PDBj:8wid
PDBsum8wid
PubMed38245551
UniProtA0QSD0|RS10_MYCS2 Small ribosomal subunit protein uS10 (Gene Name=rpsJ)

[Back to BioLiP]