Structure of PDB 8wi9 Chain k

Receptor sequence
>8wi9k (length=80) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
KIRIRLKAYDHEAIDASARKIVETVTASVVGPVPLPTEKNVYCVIRSPHK
YKDSREHFEMRTHKRLIDILLPASVDVNIQ
3D structure
PDB8wi9 Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
Chaink
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna k R7 R9 K11 H15 V37 V40 P41 L42 P43 E45 N47 R53 S54 P55 H56 K57 Y58 K59 R62 H64 H70 R72 L73 R3 R5 K7 H11 V30 V33 P34 L35 P36 E38 N40 R46 S47 P48 H49 K50 Y51 K52 R55 H57 H63 R65 L66
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wi9, PDBe:8wi9, PDBj:8wi9
PDBsum8wi9
PubMed38245551
UniProtA0QSD0|RS10_MYCS2 Small ribosomal subunit protein uS10 (Gene Name=rpsJ)

[Back to BioLiP]