Structure of PDB 8wb4 Chain k

Receptor sequence
>8wb4k (length=37) Species: 173977 (Chroomonas placoidea) [Search protein sequence]
KLPEAYAVFKPIIDVAPVIPVFFLLLAFVWQAAVGFR
3D structure
PDB8wb4 Structure and distinct supramolecular organization of a PSII-ACPII dimer from a cryptophyte alga Chroomonas placoidea.
Chaink
Resolution2.47 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA k P28 L32 P20 L24
BS02 CLA k F31 W38 Q39 F23 W30 Q31
BS03 8CT k Y14 F31 A35 W38 Y6 F23 A27 W30
BS04 8CT k I27 F30 F31 L33 L34 V37 I19 F22 F23 L25 L26 V29
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009536 plastid
GO:0009579 thylakoid
GO:0016020 membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wb4, PDBe:8wb4, PDBj:8wb4
PDBsum8wb4
PubMed38806516
UniProtA0A222AIA0

[Back to BioLiP]