Structure of PDB 8qcq Chain k

Receptor sequence
>8qcqk (length=115) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
NIESGIAHIRSTFNNTIVTITDTHGNAISWSSAGALGFRGSRKSTPFAAQ
MAAETAAKGSIEHGLKTLEVTVKGPGSGREAAIRALQAAGLEVTAIRDVT
PVPHNGCRPPKRRRV
3D structure
PDB8qcq Novel arrest peptides induce ribosome stalling by short circuiting the ribosomal peptidyltransferase activity
Chaink
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna k H24 R26 I33 T35 G41 N42 A43 W46 G56 T116 P117 V118 P119 H120 N121 C123 R124 P126 K127 R129 R130 V131 H8 R10 I17 T19 G25 N26 A27 W30 G40 T100 P101 V102 P103 H104 N105 C107 R108 P110 K111 R113 R114 V115
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qcq, PDBe:8qcq, PDBj:8qcq
PDBsum8qcq
PubMed38503735
UniProtP04969|RS11_BACSU Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]