Structure of PDB 8cvm Chain k

Receptor sequence

>8cvmk (length=144) Species: 1747 (Cutibacterium acnes)

AIELHDLKPAPGAHKAKTRVGRGEGSKGKTAGRGTKGTGARKNVPEFFAG
GQMPIHMQAPKLGGFHNPFRTEYQVVNLDKVEALFPKGGKITVDDLVSVG
AVRDNELVKVLGTGELTVKVDLVVDAWSKSAQEKIEKAGGSVTK

3D structure

• PDB: 8cvm Sarecycline inhibits protein translation in Cutibacterium acnes 70S ribosome using a two-site mechanism.
• Chain: k
• Resolution: 2.66 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	k	L5 H6 P10 G13 A14 H15 K16 K18 T19 R20 G22 R23 G24 G26 K28 G29 K30 T31 A32 G33 R34 G35 T36 K37 G38 T39 R42 K43 N44 V45 F48 F49 A50 G51 G52 Q53 M54 M58 Q59 P61 K62 G64 G65 F66 H67 N68 P69 F70 R71 Q75 V76 N78 K81 R104 K110 L112 G113 S129 K130 S131	L4 H5 P9 G12 A13 H14 K15 K17 T18 R19 G21 R22 G23 G25 K27 G28 K29 T30 A31 G32 R33 G34 T35 K36 G37 T38 R41 K42 N43 V44 F47 F48 A49 G50 G51 Q52 M53 M57 Q58 P60 K61 G63 G64 F65 H66 N67 P68 F69 R70 Q74 V75 N77 K80 R103 K109 L111 G112 S128 K129 S130
BS02	MG	k	G35 T36	G34 T35

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8cvm, PDBe:8cvm, PDBj:8cvm
• PDBsum: 8cvm
• PubMed: 36864821
• UniProt: Q6A6P5|RL15_CUTAK Large ribosomal subunit protein uL15 (Gene Name=rplO)